PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_5B57EF9FC.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 271aa    MW: 29385.8 Da    PI: 7.9755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_5B57EF9FC.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-171462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W++eEd +l+d+++ +G+g +W + + + g++R++k+c++rw++yl
  Traes_7AL_5B57EF9FC.2 14 KGPWSPEEDRKLKDYIHTHGTGgNWIALPTKAGLKRCGKSCRLRWLNYL 62
                           79*********************************************97 PP

2Myb_DNA-binding38.72.3e-1269111246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +++eEd  +  +++  G++ W+ Ia+ ++ gRt++++k++w++
  Traes_7AL_5B57EF9FC.2  69 GDFSEEEDRVICALFAAIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111
                            689******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.133962IPR017930Myb domain
SuperFamilySSF466891.25E-2612109IPR009057Homeodomain-like
SMARTSM007172.2E-121364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-241569IPR009057Homeodomain-like
CDDcd001674.78E-101662No hitNo description
PROSITE profilePS5129422.65663117IPR017930Myb domain
SMARTSM007171.1E-1167115IPR001005SANT/Myb domain
PfamPF002497.9E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2270116IPR009057Homeodomain-like
CDDcd001672.83E-871111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRAPCCDKG SVKKGPWSPE EDRKLKDYIH THGTGGNWIA LPTKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDRVIC ALFAAIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKKQLHL  120
LIAAAAQSTH GQQYSSRPPA PPFTVEHHHH TSSTSAASLG QLLMFGVGGG DHHQQQQYMS  180
SSSSVDISNN TSAAAAAAAA AGLQESFMFG GLQFQQQEED TNSLLSPAAA ASGNDIMTYE  240
HHEMISPSSF FFYGDGAGGA AATQEGTRFL Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239462.12e-87PREDICTED: transcription factor RAX2-like
TrEMBLW5H8670.0W5H867_WHEAT; Uncharacterized protein
STRINGMLOC_44167.11e-158(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-74myb domain protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]